PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011090844.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family bHLH
Protein Properties Length: 226aa    MW: 25595.5 Da    PI: 8.6067
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011090844.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH35.71.5e-1172117855
                     HHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS
             HLH   8 rErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55 
                      Er+RR+++ ++f+ L++l+P+++  +  K+ K  i   +v+YIk+L+
  XP_011090844.1  72 KERKRREQMSEKFSLLQSLVPTLV--KTFKPPKEKIIGDTVNYIKYLK 117
                     7*********************75..999*****************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088812.54464116IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SMARTSM003539.3E-1170122IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd000836.31E-971119No hitNo description
SuperFamilySSF474599.16E-1371132IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000106.9E-972116IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.109.2E-1272125IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MSERGKGECG EQETEEEEIR RLLLGIMEGY NDNVIPSLSY FSPFPGISIA EKGSSSRKRE  60
KDEISWVQSL IKERKRREQM SEKFSLLQSL VPTLVKTFKP PKEKIIGDTV NYIKYLKQET  120
ARLEGLKKSR CKEPTVAKPG LFKCTDENTS VKVAVSNGAT FLAVQLPFRR GLVPEIVRVF  180
EKHRAEVLEA RICVNEQQLL TFTATIILAS DGDSSIDKIR DEILTL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15676RKREKDEISWVQSLIKERKRR
27277ERKRRE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011090844.11e-164PREDICTED: transcription factor bHLH25-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA132481415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G09820.14e-10bHLH family protein